Recombinant Human AFG3-like protein 2(AFG3L2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP040044h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
Q9Y4W6
Gene Names
AFG3L2
Organism
Homo sapiens (Human)
AA Sequence
ERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWY LEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKE QLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVT QSAYAQIVQFGMNEKVGQISFDLPRQGDMVLEKPY SEATARLIDDEVRILINDAYKRTVALLTEKKADVE KVALLLLEKEVLDKNDMVELLGPRPFAEKSTYEEF
Expression Region
550-759aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
50.8 kDa
Alternative Name(s)
Paraplegin-like protein
Relevance
ATP-dependent protease which is essential for axonal development.
Reference
Identification and characterization of AFG3L2, a novel paraplegin-related gene.Banfi S., Bassi M.T., Andolfi G., Marchitiello A., Zanotta S., Ballabio A., Casari G., Franco B.Genomics 59:51-58(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close