Comparison

Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein(SERS),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-RP041444h-1
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P49591
Gene Names
SERS
Organism
Homo sapiens (Human)
AA Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQL VKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKK EPVGDDESVPENVLSFDDLTADALANLKVSQIKKV RLLIDEAILKCDAERIKLEAERFENLREIGNLLHP SVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVM VDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYA LRTLGSRGYIPIYTPFFMRKEV
Expression Region
2-233aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
53.4 kDa
Alternative Name
Seryl-tRNA synthetase . SerRSSeryl-tRNA(Ser/Sec) synthetase
Relevance
Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
Reference
Genomic organization, cDNA sequence, bacterial expression, and purification of human seryl-tRNA synthase.Vincent C., Tarbouriech N., Haertlein M.Eur. J. Biochem. 250:77-84(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction
Involvement in disease
Neurodevelopmental disorder with microcephaly, ataxia, and seizures (NEDMAS)
Subcellular Location
Cytoplasm, Nucleus
Protein Families
Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily
Tissue Specificity
Brain.
Amount: 1mg
Available: In stock
Listprice: €1,552.27
Price: €1,552.27
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close