Comparison

Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein(SERS),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP041444h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Seryl-tRNA synthetase ; SerRSSeryl-tRNA(Ser/Sec) synthetase
AA Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQL VKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKK EPVGDDESVPENVLSFDDLTADALANLKVSQIKKV RLLIDEAILKCDAERIKLEAERFENLREIGNLLHP SVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVM VDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYA LRTLGSRGYIPIYTPFFMRKEV
Research Topic
Metabolism
Uniprot ID
P49591
Gene Names
SERS
Tag Info
N-terminal GST-tagged
Expression Region
2-233aa
MW of Fusion Proten
53, 4
Sequence Info
Partial
Relevance
Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).
Reference
Genomic organization, cDNA sequence, bacterial expression, and purification of human seryl-tRNA synthase.Vincent C., Tarbouriech N., Haertlein M.Eur. J. Biochem. 250:77-84(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close