Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP041444h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Metabolism |
Uniprot ID |
P49591 |
Gene Names |
SERS |
Organism |
Homo sapiens (Human) |
AA Sequence |
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQL VKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKK EPVGDDESVPENVLSFDDLTADALANLKVSQIKKV RLLIDEAILKCDAERIKLEAERFENLREIGNLLHP SVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVM VDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYA LRTLGSRGYIPIYTPFFMRKEV |
Expression Region |
2-233aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
53.4 kDa |
Alternative Name(s) |
Seryl-tRNA synthetase ; SerRSSeryl-tRNA(Ser/Sec) synthetase |
Relevance |
Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec). |
Reference |
Genomic organization, cDNA sequence, bacterial expression, and purification of human seryl-tRNA synthase.Vincent C., Tarbouriech N., Haertlein M.Eur. J. Biochem. 250:77-84(1997) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction |
Involvement in disease |
Neurodevelopmental disorder with microcephaly, ataxia, and seizures (NEDMAS) |
Subcellular Location |
Cytoplasm, Nucleus |
Protein Families |
Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily |
Tissue Specificity |
Brain. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.