« Back
Home /
Recombinant Human Transaldolase(TALDO1),partial

Recombinant Human Transaldolase(TALDO1),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-RP042754h-1
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Metabolism
Uniprot ID	P37837
Gene Names	TALDO1
Organism	Homo sapiens (Human)
AA Sequence	QRMESALDQLKQFTTVVADTGDFHAIDEYKPQDAT TNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQED QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSF DKDAMVARARRLIELYKEAGISKDRILIKLSSTWE GIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGV TLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVT KIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFL TISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIH LDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLE RMLTERMFNAENGK
Expression Region	9-337aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	63.7 kDa
Relevance	Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Reference	Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence.Banki K., Halladay D.L., Perl A.J. Biol. Chem. 269:2847-2851(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Involvement in disease	Transaldolase deficiency (TALDOD)
Subcellular Location	Cytoplasm
Protein Families	Transaldolase family, Type 1 subfamily
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time