Recombinant Human Transaldolase(TALDO1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP042754h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P37837
Gene Names
TALDO1
Organism
Homo sapiens (Human)
AA Sequence
QRMESALDQLKQFTTVVADTGDFHAIDEYKPQDAT TNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQED QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSF DKDAMVARARRLIELYKEAGISKDRILIKLSSTWE GIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGV TLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVT KIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFL TISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIH LDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLE RMLTERMFNAENGK
Expression Region
9-337aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
63.7 kDa
Relevance
Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.
Reference
Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence.Banki K., Halladay D.L., Perl A.J. Biol. Chem. 269:2847-2851(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close