Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP042754h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Metabolism |
Uniprot ID |
P37837 |
Gene Names |
TALDO1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
QRMESALDQLKQFTTVVADTGDFHAIDEYKPQDAT TNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQED QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSF DKDAMVARARRLIELYKEAGISKDRILIKLSSTWE GIQAGKELEEQHGIHCNMTLLFSFAQAVACAEAGV TLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVT KIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFL TISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIH LDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLE RMLTERMFNAENGK |
Expression Region |
9-337aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
63.7 kDa |
Relevance |
Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway. |
Reference |
Cloning and expression of the human gene for transaldolase. A novel highly repetitive element constitutes an integral part of the coding sequence.Banki K., Halladay D.L., Perl A.J. Biol. Chem. 269:2847-2851(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway. |
Involvement in disease |
Transaldolase deficiency (TALDOD) |
Subcellular Location |
Cytoplasm |
Protein Families |
Transaldolase family, Type 1 subfamily |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.