Comparison

Recombinant Human EF-hand domain-containing protein KIAA0494(KIAA0494),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP044944h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MKKRKELNALIGLAGDSRRKKPKKGPSSHRLLRTE PPDSDSESSSEEEEEFGVVGNRSRFAKGDYLRCCK ICYPLCGFVILAACVVACVGLVWMQVALKEDLDAL KEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKI ESGEMGLNKVWINITEMNKQISLLTSAVNHLKANV KSAADLISLPTTVEGLQKSVASIGNTLNSVHLAVE ALQKTVDEHKKTMELLQSDMNQHFLKETPGSNQII PSPSATSELDNKTHSENLKQDILYLHNSLEEVNSA LVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVA MSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTD TVKIQSIKKEDSSNSQVSKLREKLQLISALTNKPE SNRPPETADEEQVESFTSKPSALPKFSQFLGDPVE KAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLT YQEIWTSLGSAMPEPESLRAFDSDGDGR
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O75071
Gene Names
KIAA0490
Tag Info
N-terminal GST-tagged
Expression Region
1-483aa
MW of Fusion Proten
80, 7
Sequence Info
Partial
Reference
Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.Seki N., Ohira M., Nagase T., Ishikawa K., Miyajima N., Nakajima D., Nomura N., Ohara O.DNA Res. 4:345-349(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close