« Back
Home /
Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Recombinant Human Cytochrome b-c1 complex subunit Rieske, mitochondrial(UQCRFS1)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	1mg
Host	E.coli
Item no.	CSB-RP046454h-1
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Transport
Uniprot ID	P47985
Gene Names	UQCRFS1
Organism	Homo sapiens (Human)
AA Sequence	SHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGF SYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLA LAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKE IEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCT HLGCVPIANAGDFGGYYCPCHGSHYDASGRIRLGP APLNLEVPTYEFTSDDMVIVG
Expression Region	79-274aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	48.6 kDa
Alternative Name(s)	Complex III subunit 5Cytochrome b-c1 complex subunit 5Rieske iron-sulfur protein ; RISPUbiquinol-cytochrome c reductase iron-sulfur subunit
Relevance	Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochical potential coupled to ATP synthesis.The transit peptide of the Rieske protein ses to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.
Reference	The primary structure of human Rieske iron-sulfur protein of mitochondrial cytochrome bc1 complex deduced from cDNA analysis.Nishikimi M., Hosokawa Y., Toda H., Suzuki H., Ozawa T.Biochem. Int. 20:155-160(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Subcellular Location	Mitochondrion inner membrane, Single-pass membrane protein
Paythway	Cardiacmusclecontraction
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time