Recombinant Human COMM domain-containing protein 4(COMMD4),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
ArtNr CSB-RP049644h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
Q9H0A8
Gene Names
COMMD4
Organism
Homo sapiens (Human)
AA Sequence
MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCS QVLKELLGQGIDYEKILKLTADAKFESGDVKATVA VLSFILSSAAKHSVDGESLSSELQQLGLPKEHAAS LCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDY TLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMS LSADKFQVLLAELKQAQTLM
Expression Region
1-195aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
48.4 kDa
Relevance
May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.
Reference
COMMD proteins, a novel family of structural and functional homologs of MURR1.Burstein E., Hoberg J.E., Wilkinson A.S., Rumble J.M., Csomos R.A., Komarck C.M., Maine G.N., Wilkinson J.C., Mayo M.W., Duckett C.S.J. Biol. Chem. 280:22222-22232(2005)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close