Comparison

Recombinant Human Protein canopy homolog 2(CNPY2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP050344h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
MIR-interacting saposin-like protein; Putative secreted protein Zsig9Transmembrane protein 4
AA Sequence
RSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSF RINPDGSQSVVEVPYARSEAHLTELLEEICDRMKE YGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRID SDISGTLKFACESIVEEYEDELIEFFSREADNVKD KLCSKRTDLCDHALHISHDEL
Research Topic
Metabolism
Uniprot ID
Q9Y2B0
Gene Names
CNPY2
Tag Info
N-terminal GST-tagged
Expression Region
22-182aa
MW of Fusion Proten
45, 4
Sequence Info
Full Length
Relevance
Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
Reference
MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain.Bornhauser B.C., Olsson P.-A., Lindholm D.J. Biol. Chem. 278:35412-35420(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close