Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP051244h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P04843 |
Gene Names |
RPN1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
SHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELE ARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFF TVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQ SEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVE SYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHY ENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHT GAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAA QDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLF GGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDH VFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAP DELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVH |
Expression Region |
44-427aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
70.6 kDa |
Alternative Name(s) |
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67KDA subunitRibophorin I ; RPN-IRibophorin-1 |
Relevance |
Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. |
Reference |
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. |
Subcellular Location |
Endoplasmic reticulum, Endoplasmic reticulum membrane, Single-pass type I membrane protein, Melanosome |
Protein Families |
OST1 family |
Tissue Specificity |
Expressed in all tissues tested. |
Paythway |
Proteinprocessinginendoplasmicreticulum |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.