Recombinant Human Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48KDA subunit(RPN1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP051244h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P04843
Gene Names
RPN1
Organism
Homo sapiens (Human)
AA Sequence
SHLAKVTAEVVLAHLGGGSTSRATSFLLALEPELE ARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFF TVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQ SEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVE SYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHY ENNSPFLTITSMTRVIEVSHWGNIAVEENVDLKHT GAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAA QDVYYRDEIGNVSTSHLLILDDSVEMEIRPRFPLF GGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDH VFDEQVIDSLTVKIILPEGAKNIEIDSPYEISRAP DELHYTYLDTFGRPVIVAYKKNLVEQHIQDIVVH
Expression Region
44-427aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
70.6 kDa
Alternative Name(s)
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 67KDA subunitRibophorin I ; RPN-IRibophorin-1
Relevance
Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.
Reference
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close