Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP051444h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Transcription |
Uniprot ID |
Q14919 |
Gene Names |
DRAP1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVII SRALELFLESLLKKACQVTQSRNAKTMTTSHLKQC IELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGA RRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDE SEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLP FASTLPLPPAPPGPSAPDEE |
Expression Region |
4-198aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
48.2 kDa |
Alternative Name(s) |
Dr1-associated protein 1Negative cofactor 2-alpha ; NC2-alpha |
Relevance |
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. |
Reference |
NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein.Klejman M.P., Pereira L.A., van Zeeburg H.J.T., Gilfillan S., Meisterernst M., Timmers H.T.M.Mol. Cell. Biol. 24:10072-10082(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. |
Subcellular Location |
Nucleus |
Protein Families |
NC2 alpha/DRAP1 family |
Tissue Specificity |
Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.