Comparison

Recombinant Human Dr1-associated corepressor(DRAP1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP051444h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Dr1-associated protein 1Negative cofactor 2-alpha ; NC2-alpha
AA Sequence
KKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVII SRALELFLESLLKKACQVTQSRNAKTMTTSHLKQC IELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGA RRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDE SEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLP FASTLPLPPAPPGPSAPDEE
Research Topic
Transcription
Uniprot ID
Q14919
Gene Names
DRAP1
Tag Info
N-terminal GST-tagged
Expression Region
4-198aa
MW of Fusion Proten
48, 2
Sequence Info
Partial
Relevance
The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own.
Reference
NC2alpha interacts with BTAF1 and stimulates its ATP-dependent association with TATA-binding protein.Klejman M.P., Pereira L.A., van Zeeburg H.J.T., Gilfillan S., Meisterernst M., Timmers H.T.M.Mol. Cell. Biol. 24:10072-10082(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close