Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP052444h-200 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P62906 |
Gene Names |
RPL10A |
Organism |
Homo sapiens (Human) |
AA Sequence |
KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISL KNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQH CDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYD AFLASESLIKQIPRILGPGLNKAGKFPSLLTHNEN MVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDE LVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKP QR |
Expression Region |
4-215aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
51.2 kDa |
Alternative Name(s) |
CSA-19Neural precursor cell expressed developmentally down-regulated protein 6 ; NEDD-6 |
Reference |
Identification of genes downregulated in the thymus by cyclosporin-A preliminary characterization of clone CSA-19.Fisicaro N., Katerelos M., Williams J., Power D., D'Apice A., Pearse M.Mol. Immunol. 32:565-572(1995) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the large ribosomal subunit. |
Protein Families |
Universal ribosomal protein uL1 family |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.