Comparison

Recombinant Human 60S ribosomal protein L10a(RPL10A),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP052444h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CSA-19Neural precursor cell expressed developmentally down-regulated protein 6 ; NEDD-6
AA Sequence
KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISL KNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQH CDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYD AFLASESLIKQIPRILGPGLNKAGKFPSLLTHNEN MVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDE LVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKP QR
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P62906
Gene Names
RPL10A
Tag Info
N-terminal GST-tagged
Expression Region
4-215aa
MW of Fusion Proten
51, 2
Sequence Info
Partial
Reference
Identification of genes downregulated in the thymus by cyclosporin-A preliminary characterization of clone CSA-19.Fisicaro N., Katerelos M., Williams J., Power D., D'Apice A., Pearse M.Mol. Immunol. 32:565-572(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close