Recombinant Human Gamma-aminobutyric acid receptor-associated protein(GABARAP),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP054844h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
O95166
Gene Names
GABARAP
Organism
Homo sapiens (Human)
AA Sequence
KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKA PKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR AEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLY IAYSDESVYGL
Expression Region
2-117aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
40.8 kDa
Alternative Name(s)
GABA(A) receptor-associated protein; MM46
Relevance
Ubiquitin-like modifier that plays a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in apoptosis. Involved in autophagy. Whereas LC3s are involved in elongation of the phagophore mbrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Reference
The human homolog of Saccharomyces cerevisiae Apg7p is a Protein-activating enzyme for multiple substrates including human Apg12p, GATE-16, GABARAP, and MAP-LC3.Tanida I., Tanida-Miyake E., Ueno T., Kominami E.J. Biol. Chem. 276:1701-1706(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close