Recombinant Human C-C motif chemokine 24(CCL24)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP059094h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
O00175
Gene Names
CCL24
Organism
Homo sapiens (Human)
AA Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKA GVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKA SPRARAVAVKGPVQRYPGNQTTC
Expression Region
27-119aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
MW
14.5 kDa
Alternative Name(s)
CK-beta-6Eosinophil chemotactic protein 2Eotaxin-2Myeloid progenitor inhibitory factor 2 ; MPIF-2Small-inducible cytokine A24
Relevance
Chotactic for resting T-lymphocytes, and eosinophils. Has lower chotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hatopoietic progenitor cell line. Binds to CCR3.
Reference
Molecular and functional characterization of two novel human C-C chemokines as inhibitors of two distinct classes of myeloid progenitors.Patel V.P., Kreider B.L., Li Y., Li H., Leung K., Salcedo T., Nardelli B., Pippalla V., Gentz S., Thotakura R., Parmelee D., Gentz R., Garotta G.J. Exp. Med. 185:1163-1172(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close