« Back
Home /
Recombinant Human C-C motif chemokine 7(CCL7)

Recombinant Human C-C motif chemokine 7(CCL7)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP059654h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Immunology
Uniprot ID	P80098
Gene Names	CCL7
Organism	Homo sapiens (Human)
AA Sequence	QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSH CPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKK TQTPKL
Expression Region	24-99aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	36 kDa
Alternative Name(s)	Monocyte chemoattractant protein 3Monocyte chemotactic protein 3 ; MCP-3NC28Small-inducible cytokine A7
Relevance	Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
Reference	Determination of the three-dimensional structure of CC chemokine monocyte chemoattractant protein 3 by 1H two-dimensional NMR spectroscopy.Meunier S., Bernassau J.-M., Guillemot J.-C., Ferrara P., Darbon H.Biochemistry 36:4412-4422(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
Subcellular Location	Secreted
Protein Families	Intercrine beta (chemokine CC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time