Recombinant Human C-C motif chemokine 7(CCL7)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP059654h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P80098
Gene Names
CCL7
Organism
Homo sapiens (Human)
AA Sequence
QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSH CPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKK TQTPKL
Expression Region
24-99aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
36 kDa
Alternative Name(s)
Monocyte chemoattractant protein 3Monocyte chemotactic protein 3 ; MCP-3NC28Small-inducible cytokine A7
Relevance
Chotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
Reference
Determination of the three-dimensional structure of CC chemokine monocyte chemoattractant protein 3 by 1H two-dimensional NMR spectroscopy.Meunier S., Bernassau J.-M., Guillemot J.-C., Ferrara P., Darbon H.Biochemistry 36:4412-4422(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close