Recombinant Human CD40 ligand(CD40LG),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP060054h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
P29965
Gene Names
CD40LG
Organism
Homo sapiens (Human)
AA Sequence
HRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLSL LNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKG DQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNN LVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQ SIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSF GL
Expression Region
47-258aa
Sequence Info
Extracellular Domain
Tag Info
N-terminal GST-tagged
MW
50.8 kDa
Alternative Name(s)
T-cell antigen Gp39TNF-related activation protein ; TRAPTumor necrosis factor ligand superfamily member 5; CD154
Relevance
Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching.
Reference
Mutations of the CD40 ligand gene and its effect on CD40 ligand expression in patients with X-linked hyper IgM syndrome.Seyama K., Nonoyama S., Gangsaas I., Hollenbaugh D., Pabst H.F., Aruffo A., Ochs H.D.Blood 92:2421-2434(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close