Comparison

Recombinant Human C-X-C motif chemokine 10 protein(CXCL10)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP061074h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
10 kDa interferon gamma-induced protein ; Gamma-IP10 ; IP-10Small-inducible cytokine B10
AA Sequence
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQF CPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK ERSKRSP
Research Topic
Immunology
Uniprot ID
P02778
Gene Names
CXCL10
Tag Info
N-terminal 6xHis-tagged
Expression Region
22-98aa
MW of Fusion Proten
12, 6
Sequence Info
Full Length
Relevance
Chotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Reference
Processing of natural and recombinant CXCR3-targeting chemokines and implications for biological activity.Hensbergen P.J., van der Raaij-Helmer E.M.H., Dijkman R., van der Schors R.C., Werner-Felmayer G., Boorsma D.M., Scheper R.J., Willemze R., Tensen C.P.Eur. J. Biochem. 268:4992-4999(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close