« Back
Home /
Recombinant Mouse Heparin-binding growth factor 2 protein(Fgf-2)

Recombinant Mouse Heparin-binding growth factor 2 protein(Fgf-2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP062594m-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	P15655
Gene Names	Fgf-2
Organism	Mus musculus (Mouse)
AA Sequence	PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHP DGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCAN RYLAMKEDGRLLASKCVTEECFFFERLESNNYNTY RSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLP MSAKS
Expression Region	10-154aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	20.3 kDa
Alternative Name(s)	Basic fibroblast growth factor ; bFGFHeparin-binding growth factor 2 ; HBGF-2
Relevance	Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro .
Reference	Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis.
Subcellular Location	Secreted, Nucleus
Protein Families	Heparin-binding growth factors family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time