Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP062594m-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P15655 |
Gene Names |
Fgf-2 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHP DGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCAN RYLAMKEDGRLLASKCVTEECFFFERLESNNYNTY RSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLP MSAKS |
Expression Region |
10-154aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
20.3 kDa |
Alternative Name(s) |
Basic fibroblast growth factor ; bFGFHeparin-binding growth factor 2 ; HBGF-2 |
Relevance |
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro . |
Reference |
Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis. |
Subcellular Location |
Secreted, Nucleus |
Protein Families |
Heparin-binding growth factors family |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.