Comparison

Recombinant Mouse Heparin-binding growth factor 2 protein(Fgf-2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP062594m-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Basic fibroblast growth factor ; bFGFHeparin-binding growth factor 2 ; HBGF-2
AA Sequence
PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHP DGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCAN RYLAMKEDGRLLASKCVTEECFFFERLESNNYNTY RSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLP MSAKS
Research Topic
Others
Uniprot ID
P15655
Gene Names
Fgf-2
Tag Info
N-terminal 6xHis-tagged
Expression Region
10-154aa
MW of Fusion Proten
20, 3
Sequence Info
Full Length
Relevance
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro .
Reference
Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis.Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R.Dev. Biol. 138:454-463(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close