Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP063294h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Cardiovascular |
Uniprot ID |
Q9UNN8 |
Gene Names |
PROCR |
Organism |
Homo sapiens (Human) |
AA Sequence |
SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGG HLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQ SYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPP EGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVT SGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQK HISAENTKGSQTSRSYTS |
Expression Region |
18-210aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
26 kDa |
Alternative Name(s) |
Activated protein C receptor ; APC receptorEndothelial cell protein C receptor; CD201 |
Relevance |
Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation. |
Reference |
Identification, cloning, and regulation of a novel endothelial cell protein C/activated protein C receptor.Fukudome K., Esmon C.T.J. Biol. Chem. 269:26486-26491(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney. |
Paythway |
Complementandcoagulationcascades |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.