Recombinant Human Endothelial protein C receptor(PROCR) ,partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP063294h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
Q9UNN8
Gene Names
PROCR
Organism
Homo sapiens (Human)
AA Sequence
SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGG HLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQ SYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPP EGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVT SGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQK HISAENTKGSQTSRSYTS
Expression Region
18-210aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
26 kDa
Alternative Name(s)
Activated protein C receptor ; APC receptorEndothelial cell protein C receptor; CD201
Relevance
Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
Reference
Identification, cloning, and regulation of a novel endothelial cell protein C/activated protein C receptor.Fukudome K., Esmon C.T.J. Biol. Chem. 269:26486-26491(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close