« Back
Home /
Recombinant Human Glial cell line-derived neurotrophic factor(GDNF)

Recombinant Human Glial cell line-derived neurotrophic factor(GDNF)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	200ug
Host	E.coli
Item no.	CSB-RP064624h-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Neuroscience
Uniprot ID	P39905
Gene Names	GDNF
Organism	Homo sapiens (Human)
AA Sequence	SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQR GKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSG SCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPI AFDDDLSFLDDNLVYHILRKHSAKRCGCI
Expression Region	78-211aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	Tag-Free
MW	15.1 kDa
Alternative Name(s)	Astrocyte-derived trophic factor ; ATF
Relevance	Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Reference	GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Involvement in disease	Hirschsprung disease 3 (HSCR3); Congenital central hypoventilation syndrome (CCHS); Pheochromocytoma (PCC)
Subcellular Location	Secreted
Protein Families	TGF-beta family, GDNF subfamily
Tissue Specificity	In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is found in pancreatic islets. Isoform 5 is expressed at very low levels in putamen, nucleus accumbens, prefrontal cortex, amygdala, hypothalamus and intestine. Isoform 3 is up-regulated in the middle temporal gyrus of Alzheimer disease patients while isoform 2 shows no change.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time