Comparison

Recombinant Human Glial cell line-derived neurotrophic factor(GDNF)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP064624h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Astrocyte-derived trophic factor ; ATF
AA Sequence
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQR GKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSG SCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPI AFDDDLSFLDDNLVYHILRKHSAKRCGCI
Research Topic
Neuroscience
Uniprot ID
P39905
Gene Names
GDNF
Tag Info
NO-tagged
Expression Region
78-211aa
MW of Fusion Proten
15, 1
Sequence Info
Full Length
Relevance
Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake.
Reference
GDNF a glial cell line-derived neurotrophic factor for midbrain dopaminergic neurons.Lin L.-F.H., Doherty D.H., Lile J.D., Bektesh S., Collins F.Science 260:1130-1132(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €787.28
Price: €787.28
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close