Recombinant Human Insulin-like growth factor I(IGF1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP065544h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P05019
Gene Names
IGF1
Organism
Homo sapiens (Human)
AA Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSS RRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Expression Region
49-118aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
34.7 kDa
Alternative Name(s)
Mechano growth factor ; MGFSomatomedin-C
Relevance
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation.
Reference
Characterization of insulin-like growth factor 1 in human primary brain tumors.Sandberg-Nordqvist A.-C., Staehlbom P.-A., Reinecke M., Collins V.P., von Holst H., Sara V.Cancer Res. 53:2475-2478(1993)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close