Recombinant Human Interleukin-1 alpha(IL1A)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP065654h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P01583
Gene Names
IL1A
Organism
Homo sapiens (Human)
AA Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRA NDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITV ILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGS ETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWV CLAGGPPSITDFQILENQA
Expression Region
113-271aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
MW
45 kDa
Alternative Name(s)
Hematopoietin-1
Relevance
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Reference
Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs.March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647(1985)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close