Comparison

Recombinant Human Macrophage migration inhibitory factor(MIF)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP068674h-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Glycosylation-inhibiting factor ; GIFL-dopachrome isomeraseL-dopachrome tautomerase (EC:5.3.3.12)Phenylpyruvate tautomerase
AA Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQ YIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGA QNRSYSKLLCGLLAERLRISPDRVYINYYDMNAAN VGWNNSTFA
Research Topic
Immunology
Uniprot ID
P14174
Gene Names
MIF
Tag Info
N-terminal 6xHis-tagged
Expression Region
2-115aa
MW of Fusion Proten
16, 3
Sequence Info
Full Length
Relevance
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
Reference
Molecular cloning of a cDNA encoding a human macrophage migration inhibitory factor.Weiser W.Y., Temple P.A., Witek-Giannotti J.S., Remold H.G., Clark S.C., David J.R.Proc. Natl. Acad. Sci. U.S.A. 86:7522-7526(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close