Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-RP070094h-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Developmental Biology |
Target / Protein |
MMP1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P03956 |
AA Sequence |
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIE KAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRD NSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTN NFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTP KACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYP EVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKG NKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAA LSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMI AHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPK TKRILTLQKANSWFNCRKN |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
101-469aa |
Protein length |
Partial |
MW |
46.5 kDa |
Alternative Name(s) |
Fibroblast collagenase; Matrix metalloproteinase-1 ; MMP-1 |
Relevance |
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. |
References |
Cloning and characterization of human tumor cell interstitial collagenase.Templeton N.S., Brown P.D., Levy A.T., Margulies I.M.K., Liotta L.A., Stetler-Stevenson W.G.Cancer Res. 50:5431-5437(1990) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X |
Subcellular Location |
Secreted, extracellular space, extracellular matrix |
Protein Families |
Peptidase M10A family |
Paythway |
PPARsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.