Recombinant Human Interstitial collagenase(MMP1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
ArtNr CSB-RP070094h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Developmental Biology
Uniprot ID
P03956
Gene Names
MMP1
Organism
Homo sapiens (Human)
AA Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIE KAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRD NSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTN NFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTP KACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYP EVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKG NKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAA LSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMI AHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPK TKRILTLQKANSWFNCRKN
Expression Region
101-469aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
46.5 kDa
Alternative Name(s)
Fibroblast collagenase; Matrix metalloproteinase-1 ; MMP-1
Relevance
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
Reference
Cloning and characterization of human tumor cell interstitial collagenase.Templeton N.S., Brown P.D., Levy A.T., Margulies I.M.K., Liotta L.A., Stetler-Stevenson W.G.Cancer Res. 50:5431-5437(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €496.43
Price: €496.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close