Comparison

Recombinant Human Interstitial collagenase(MMP1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP070094h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Fibroblast collagenase; Matrix metalloproteinase-1 ; MMP-1
AA Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIE KAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRD NSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTN NFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTP KACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYP EVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKG NKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAA LSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMI AHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPK TKRILTLQKANSWFNCRKN
Research Topic
Developmental Biology
Uniprot ID
P03956
Gene Names
MMP1
Tag Info
N-terminal 6xHis-tagged
Expression Region
101-469aa
MW of Fusion Proten
46, 5
Sequence Info
Partial
Relevance
Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
Reference
Cloning and characterization of human tumor cell interstitial collagenase.Templeton N.S., Brown P.D., Levy A.T., Margulies I.M.K., Liotta L.A., Stetler-Stevenson W.G.Cancer Res. 50:5431-5437(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close