Recombinant Human Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP072244h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Apoptosis
Uniprot ID
P19438
Gene Names
TNFRSF1A
Organism
Homo sapiens (Human)
AA Sequence
VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKG TYLYNDCPGPGQDTDCRECESGSFTASENHLRHCL SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHY WSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHA GFFLRENECVSCSNCKKSLECTKLCLPQIENVKGT EDSGT
Expression Region
31-210aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
47.2 kDa
Alternative Name(s)
Tumor necrosis factor receptor 1 ; TNF-R1Tumor necrosis factor receptor type I ; TNF-RI ; TNFR-Ip55p60; CD120a
Relevance
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Reference
Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.Wang P., Yu P., Gao P., Shi T., Ma D.BMC Genomics 10:518-518(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close