Recombinant Rat Alpha-synuclein(Snca)

Manufacturer Cusabio
Category
Type Proteins
Specific against Rat
Amount 50ug
Host E.coli
ArtNr CSB-EP021912RAe0-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Others
Target / Protein
Snca
Biologically active
Not Test
Species of origin
Rattus norvegicus (Rat)
Uniprot ID
P37377
AA Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKE GVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEE GYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Tag info
N-terminal GST-tagged
Expression Region
1-140aa
Protein length
Full Length
MW
41.5 kDa
Relevance
May be involved in the regulation of dopamine release and transport.
Reference
The UCH-L1 gene encodes two opposing enzymatic activities that affect alpha-synuclein degradation and Parkinson's disease susceptibility.Liu Y., Fallon L., Lashuel H.A., Liu Z., Lansbury P.T. Jr.Cell 111:209-218(2002)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close