Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase(YNK1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Yeast
Amount 50ug
Host E.coli
ArtNr CSB-EP015889SVG-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Others
Target / Protein
YNK1
Biologically active
Not Test
Species of origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot ID
P36010
AA Sequence
MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYK LVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMK SGPILATVWEGKDVVRQGRTILGATNPLGSAPGTI RGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEEL VDWESNQAKWIYE
Tag info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region
1-153aa
Protein length
Full Length
MW
37.2 kDa
Alternative Name(s)
NDK1, YNK
Relevance
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage.
Reference
"Sequence of a 20.7 kb region of yeast chromosome XI includes the NUP100 gene, an open reading frame (ORF) possibly representing a nucleoside diphosphate kinase gene, tRNAs for His, Val and Trp in addition to seven ORFs with weak or no significant similarity to known proteins."
Rasmussen S.W.
Yeast 10:S69-S74(1994)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close