Comparison

MOUSE ANTI HUMAN ACTIVIN BetaC-SUBUNIT

Manufacturer GENWAY
Category
Type Antibody
Specific against Human
Applications WB
Amount 0.05 mg
Host Mouse
Item no. 20-783-314838
eClass 6.1 32160702
eClass 9.0 32160702
Available
Genway ID:
GWB-3C04EE
Specificity:
ACTIVIN Beta C-SUBUNIT
Isotype:
IgG1Species Cross Reactivity: Reacts with: RatN. B. Antibody reactivity and working conditions may vary between species.
Preparation:
Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
Preservative Stabilisers:
0. 09% Sodium Azide (NaN3)Approx. Protein Concentrations: IgG concentration 0. 5mg/ml
Immunogen:
Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human activin BetaC-subunit.
Specificity:
Is specific for the BetaC-subunit of Activin (BetaC-activin) a member of the transforming growth factor beta (TGF-beta) superfamily and one of a group of proteins which regulate growth and differentiation in a range of cells and tissues via both autocrine and paracrine pathways. Activins were originally characterised by the formation of specific homo- and heterodimers of activin BetaA- or BetaB-subunits but additional subunits of activin have since been identified including BetaC BetaD and BetaE. BetaC-activin expressed in the liver prostrate ovary and testis has been shown to exhibit both growth promoting and inhibitory properties and evidence suggests that BetaC-activin can form BetaC homodimers and also heterodimers with BetaA (putative activin AC) and BetaB (putative activin BC).
Specificity:
Has been shown to recognise both monomeric and dimeric BetaC-activin and does not cross react with BetaAf BetaB or BetaE. Recommended Secondary Antibodies: Rabbit Anti Mouse IgGGoat Anti Mouse IgGGoat Anti Mouse IgG (H/L)Goat Anti Mouse IgG IgA IgMHuCAL Anti Mouse IgG1Goat Anti Mouse IgG (Fc)Sheep Anti Mouse IgG (H/L)
Function:
Inhibins and activins inhibit and activate respectively the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion gonadal hormone secretion germ cell development and maturation erythroid differentiation insulin secretion nerve cell survival embryonic axial development or bone growth depending on their subunit composition. Inhibins appear to oppose the functions of activins. Subunit structureHomodimeric or heterodimeric through association with alpha and beta subunits linked by one or more disulfide bonds. Inhibins are heterodimers of one alpha and one beta subunit. Activins are homo- or heterodimers of beta subunits only By similarity. Subcellular locationSecreted By similarity. Tissue specificityExpressed in benign prostatic hyperplasia. Ref. 4Sequence similaritiesBelongs to the TGF-beta family.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Delivery expected until 5/30/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close