Comparison

Recombinant Human IL36 gamma/IL-1F9 Protein

Manufacturer Abclonal
Category
Specific against other
Amount 200 ug
Item no. RP00035-200ug
Available
Remarks (NCBI alias)
IL36G
GeneID(Human)
56300
Route
No tag
Imminogen
Ser18-Asp169
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
BackGround
The protein is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection.
RecommandDilutionA
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
Cross-Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol
IL36G
ProteinFormulation
Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
ProteinDescription
Recombinant Human IL36 gamma/IL-1F9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser18-Asp169) of human Interleukin-36 gamma (Accession #NP_062564.1 ).
ProteinBioActivity
The NF-kB (Luc) HEK293 Reporter Cell was stimulated with serial dilutions of human IL-36 gamma protein. After 7 hours, 2.5 ng/mL of human IL-36 gamma can effectively activate the NF-κB signaling.
AntigenSeq
SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Delivery expected until 6/22/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close