« Back
Home /
Recombinant Human IL-8/CXCL8/GCP-1 Protein

Recombinant Human IL-8/CXCL8/GCP-1 Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	500 ug
Item no.	RP00052-500ug
Available
Remarks (NCBI alias)	CXCL8
GeneID(Human)	3576
Route	No tag
Imminogen	Ala23-Ser99
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
BackGround	The protein is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	CXCL8
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
ProteinDescription	Recombinant Human IL-8/CXCL8/GCP-1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala23-Ser99) of human IL-8 (Accession #NP_000575.1).
ProteinBioActivity	Measured by its ability to enhance Bcl2 expression in HCT116 human colon adenocarcinoma cells. 0.01-1ng/mL of Recombinant Human RSPO1 can effectively enhance Bcl2 expression.
AntigenSeq	AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 6/22/2023