Manufacturer |
Abclonal
|
Category |
|
Specific against |
other |
Amount |
1000 ug |
Item no. |
RP00391-1000ug |
Available |
|
Remarks (NCBI alias) |
IGFBP7 |
GeneID(Human) |
3490 |
Route |
C-6×His |
Imminogen |
Ser27-Leu282 |
Storage |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
BackGround |
This protein belongs a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307). |
RecommandDilutionA |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Cross-Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
GeneSymbol |
IGFBP7 |
ProteinFormulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
ProteinDescription |
Recombinant Human IGFBP-7 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ser27-Leu282) of human IGFBP-7 (Accession #Q16270) fused with a 6×His tag at the C-terminus. |
ProteinBioActivity |
Measured by its ability to bind 6Ckine/CCL21 in a functional ELISA. When Recombinant Human IGFBP-7 is immobilized at 500 ng/mL (100 μL/well), the concentration of Recombinant Human CCL21/6Ckine that produces 50% optimal binding response is found to be approximately 4-20 ng/mL. |
AntigenSeq |
SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAE |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.