Comparison

Recombinant Human S100-A8 Protein

Manufacturer Abclonal
Category
Specific against other
Amount 500 ug
Item no. RP00440LQ-500ug
Available
Remarks (NCBI alias)
S100A8
GeneID(Human)
6279
Route
C-His
Imminogen
Met1-Glu93
Storage
This product is stable at ≤ -70° C for up to 1 year from the date of receipt.
For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
BackGround
This protein is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
RecommandDilutionA
Supplied as a 0.2 μm filtered solution of 20mMHEPES, 150mMnacl, 2.5mMEDTA, 10%Glycerol, pH7.0.
GeneSymbol
S100A8
ProteinFormulation
Supplied as a 0.2 μm filtered solution of 20mMHEPES, 150mMnacl, 2.5mMEDTA, 10%Glycerol, pH7.0.
ProteinDescription
Recombinant Human S100-A8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu93) of human S100A8/Protein S100-A8 (Accession #P05109) fused with a 6×His tag at the C-terminus.
AntigenSeq
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 6/22/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close