Comparison

Recombinant Mouse CXCL12/SDF-1 alpha Protein

Manufacturer Abclonal
Category
Specific against other
Amount 500 ug
Item no. RP00548-500ug
Available
Remarks (NCBI alias)
CXCL12
Route
No tag
Imminogen
Lys22-Lys89
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
BackGround
Mouse Cxcl12 is a secreted and highly conserved protein which belongs to the intercrine alpha (chemokine CxC)family.CXCL12 is widely expressed in various organs including brain, kidney, skeletal muscle, heart, liver, and lymphoidorgans. Cxcl12 activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level ofintracellular calcium ions and chemotaxis. It also binds to atypical chemokine receptor ACKR3 which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Cxcl12 has several critical functions during embryonicdevelopment such as B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Cxcl12plays an important role in acting as a positive regulator of monocyte migration and a negative regulator of monocyteadhesion via the LYN kinase. It stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 andACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. It also plays aprotective role after myocardial infarction, induces down-regulation and internalization of ACKR3 expressed in various cellsand stimulates the proliferation of bone marrow-derived b progenitor cells in the presence of IL-7 as well as growth of thestromal cell-dependent B-cell clone DW34 cells.
RecommandDilutionA
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Cross-Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol
CXCL12
ProteinFormulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
ProteinDescription
Recombinant Mouse CXCL12/SDF-1 alpha Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys22-Lys89) of mouse CXCL12/SDF-1 alpha (Accession #P40224) fused with an initial Met at the N-terminus.
ProteinBioActivity
Measured by its ability to chemoattract 5-10 day cultured human peripheral blood lymphocytes (PBL). The ED50 for this effect is 10-30 ng/mL. Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR4. The ED50 for this effect is 0.3-1.5 ng/mL.
AntigenSeq
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 7/27/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close