Comparison

Recombinant Mouse IL-21 Protein

Manufacturer Abclonal
Category
Specific against other
Amount 500 ug
Item no. RP00664-500ug
Available
Remarks (NCBI alias)
IL-21
Route
No tag
Imminogen
Pro25-Ser146
Storage
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
BackGround
Interleukin-21 also known as IL-21 is a protein that in mouse is encoded by the IL21 gene, belongs to the IL-15/IL-21 family. Interleukin-21 is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. Thiscytokine induces cell division/proliferation in its target cells.
RecommandDilutionA
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Cross-Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol
IL-21
ProteinFormulation
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
ProteinDescription
Recombinant Mouse IL-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro25-Ser146) of mouse IL-21 (Accession #Q9ES17) fused with an initial Met at the N-terminus.
AntigenSeq
PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 7/27/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close