« Back
Home /
Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	1000 ug
Item no.	RP00688-1000ug
Available
Remarks (NCBI alias)	IFNA2
Route	No tag
Imminogen	Cys24-Glu190
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
BackGround	At least 23 different variants of Interferon- α are known. The individual proteins have molecular massesbetween 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- α subtypespossess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- α subtypes differ in their sequences at only one or two positions.Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
RecommandDilutionA	Lyophilized from a 0.2 μM filtered solution of 20mM PB, 100mM Nacl, pH7.4Contact us for customized product form or formulation.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
GeneSymbol	IFNA2
ProteinFormulation	Lyophilized from a 0.2 μM filtered solution of 20mM PB, 100mM Nacl, pH7.4Contact us for customized product form or formulation.
ProteinDescription	Recombinant Mouse IFNA2/IFN-alpha 2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu190) of mouse IFNA2/IFN-alpha 2 (Accession #P01573) fused with an initial Met at the N-terminus.
AntigenSeq	CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 ug

available

Delivery expected until 7/27/2023