Recombinant Mouse IL-1 R2/IL-1 RII Protein

IL-1 RII

Phe14-Glu355

Mouse Interleukin 1 receptor, type II (IL1R2) is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. IL-1R2 structurally consistingof a ligand binding portion comprised of three Ig-like domains, a single transmembrane region, and a shortcytoplasmic domain. It is expressed in a variety of cell types including B lymphocytes, neutrophils, monocytes, large granular leukocytes and endothelial cells. Mouse IL1RII shares 59% amino acid sequence homology withhuman IL1 RII in their extracellular domains. The pleiotropic cytokine IL1 is produced to regulate developmentand maintenance of the inflammatory responses, and binds to specific plasma membrane receptors on cells.Two distinct types of IL1 receptors which are able to bind IL1 specifically have been identified, designated asIL1RI (IL1RA) and IL1RII (IL1RB). IL1R1 contributes to IL-1 signaling, whereas the IL-1R2 has no signalingproperty and acts as a decoy for IL-1.

Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

FTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPVVLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYICTFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLGSRLIV