Recombinant Mouse IL-1 R1/IL-1 RI Protein

IL-1 RI

Leu20-Lys338

Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1receptor antagonist (IL1RA). It is an important mediator involved in many cytokine induced immune andinflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor inthe presence of IL1α or IL1β but not IL1ra, was identified. This Type I receptor complex appears to mediate allthe known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does nottransduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form ofIL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or asthe soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signalingType I receptor complex.

Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWND