« Back
Home /
Recombinant Mouse CCL8/MCP-2 Protein

Recombinant Mouse CCL8/MCP-2 Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	10 ug
Item no.	RP00773-10ug
Available
Remarks (NCBI alias)	CCL8
Route	C-6×His
Imminogen	Glu20-Pro97
Storage	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
BackGround	Chemokine ligand 8 (CCL8, MCP-2), is a small secreted cytokine which belongs to the intercrine beta(chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions toactivate different immune cells, including mast cells, eosinophils and basophils which are involved in allergicresponses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its abilityachieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B andCCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is oneof the major co-receptors for HIV-1.
RecommandDilutionA	Lyophilized from a 0.2 μm filtered solution of 20mM Hac-NaC, 150mM NaCl, pH4.0.Contact us for customized product form or formulation.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	CCL8
ProteinFormulation	Lyophilized from a 0.2 μm filtered solution of 20mM Hac-NaC, 150mM NaCl, pH4.0.Contact us for customized product form or formulation.
ProteinDescription	Recombinant Mouse CCL8/MCP-2 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Glu20-Pro97) of mouse CCL8/MCP-2 (Accession #Q9Z121) fused with a 6×His tag at the C-terminus.
AntigenSeq	EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 6/22/2023