« Back
Home /
Recombinant Mouse Siglec-15/CD33L3 Protein

Recombinant Mouse Siglec-15/CD33L3 Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	20 ug
Item no.	RP01289-20ug
Available
Remarks (NCBI alias)	SIGLEC15
GeneID(Human)	SIGLEC15
Route	C-His
Imminogen	Arg24-Thr262
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	SIGLEC15
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription	Recombinant Mouse Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg24-Thr262) of mouse Siglec-15/CD33L3 (Accession #NP_001094508.1) fused with a 6×His tag at the C-terminus.
AntigenSeq	RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 7/27/2023