Manufacturer |
Abclonal
|
Category |
|
Specific against |
other |
Amount |
20 ug |
Item no. |
RP01308-20ug |
Available |
|
Remarks (NCBI alias) |
NOG |
GeneID(Human) |
NOG |
Route |
C-His |
Imminogen |
Gln28-Cys232 |
Storage |
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
BackGround |
Noggin is a secreted protein involved at multiple stages of vertebrate embryonic development including neural induction and is known to exert its effects by inhibiting the bone morphogenetic protein (BMP)-signaling pathway. It binds several BMPs with very high (picomolar) affinities, with a marked preference for BMP2 and BMP4 over BMP7. By binding tightly to BMPs, Noggin prevents BMPs from binding their receptors. Noggin binds the bone morphogenetic proteins (BMP) such as BMP-4 and BMP-7 and inhibits BMP signaling by blocking the molecular interfaces of the binding epitopes for both types I and type II receptors. Interaction of BMP and its antagonist Noggin governs various developmental and cellular processes, including embryonic dorsal-ventral axis, induction of neural tissue, the formation of joints in the skeletal system, and neurogenesis in the adult brain. Noggin plays a key role in neural induction by inhibiting BMP4, along with other TGF-β signaling inhibitors such as chordin and follistatin. Mouse knockout experiments have demonstrated that noggin also plays a crucial role in bone development, joint formation, and neural tube fusion. |
RecommandDilutionA |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Cross-Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
GeneSymbol |
NOG |
ProteinFormulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
ProteinDescription |
Active Recombinant Mouse Noggin/NOG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln28-Cys232) of mouse Noggin (Accession #NP_032737.1) fused with an 6×His tag at the C-terminus. |
ProteinBioActivity |
1.Measured by its binding ability in a functional ELISA.Immobilized Human BMP4 at 0.5 μg/mL (100 μL/well) can bind Noggin with a linear range of 4-29 ng/mL.2.Measured by its binding ability in a functional ELISA.Immobilized Human Noggin at 1 μg/mL (100 μL/well) can bind Noggin Rabbit pAb with a linear range of 1-4.95 ng/mL.3.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50?for this effect is 3.5-14 ng/mL in the presence of 50 ng/mL of Recombinant Human BMP-4. |
AntigenSeq |
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.