Manufacturer |
Abclonal
|
Category |
|
Specific against |
other |
Amount |
100 ug |
Item no. |
RP01345-100ug |
Available |
|
Remarks (NCBI alias) |
FGFb |
GeneID(Human) |
FGFb |
Route |
C-His |
Imminogen |
Ala11-Ser154 |
Storage |
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
BackGround |
Basic fibroblast growth factor (bFGF), also known as FGF2, is a member of the fibroblast growth factor (FGF) family. It is a highly specific chemotactic and mitogenic factor for many cell types, appears to be involved in remodeling damaged tissue, such as ulcer healing, vascular repair, traumatic brain injury (TBI). bFGF is a critical component of human embryonic stem cell culture medium. In addition, bFGF protein is a heparin-binding cationic protein involved in a variety of pathological conditions including angiogenesis and solid tumour growth. Thus, bFGF is regarded as a target for cancers chemopreventive and therapeutic strategies. |
RecommandDilutionA |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Cross-Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
GeneSymbol |
FGFb |
ProteinFormulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
ProteinDescription |
Active Recombinant Mouse FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala11-Ser154) of mouse FGF2/FGFB (Accession #NP_032032.1) fused with 6×His tag at the C-terminus. |
ProteinBioActivity |
Active Recombinant Mouse FGF2 was added during DP cell culture. The immunofluorescence identification showed that 1 ng/mL FGF2 could maintain the cellular characteristics of DP cells. The red part is the fluorescently labeled PDFGRA antibody, and the blue-cyan part is the DAPI-stained cells. |
AntigenSeq |
ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.