« Back
Home /
Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein

Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	100 ug
Item no.	RP01366-100ug
Available
Remarks (NCBI alias)	FCGR3A
GeneID(Human)	FCGR3A
Route	C-His
Imminogen	Gly17-Gln208(F176V)
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround	This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	FCGR3A
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription	Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Gln208(F176V)) of human FCGR3A/CD16A(F176V) (Accession #NP_001121065.1) fused with a 6×His tag at the C-terminus.
AntigenSeq	GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 7/27/2023