« Back
Home /
Recombinant Human PTH1R Protein

Recombinant Human PTH1R Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	20 ug
Item no.	RP01369-20ug
Available
Remarks (NCBI alias)	PTH1R
GeneID(Human)	PTH1R
Route	C-His
Imminogen	Asp27-Gly188
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround	Parathyroid hormone / parathyroid hormone-related peptide receptor, also known as PTH / PTHrP type I receptor, PTH/PTHr receptor, Parathyroid hormone 1 receptor, PTH1 receptor, PTH1R and PTHR, is a multi-pass membrane protein which belongs to the G-protein coupled receptor 2 family. PTH1R is expressed in most tissues. It is most abundant in kidney, bone and liver. PTH1R is expressed in high levels in bone and kidney and regulates calcium ion homeostasis through activation of adenylate cyclase and phospholipase C. In bone, PTH1R is expressed on the surface of osteoblasts. When the receptor is activated, these cells in turn stimulate osteoclasts to ultimately increase the resorption rate. PTH1R is a receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of PTH1R is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system. Defects in PTH1R are the cause of Jansen metaphyseal chondrodysplasia (JMC), chondrodysplasia Blomstrand type (BOCD), enchondromatosis multiple (ENCHOM), Eiken skeletal dysplasia (EISD) and primary failure of tooth eruption (PFE).
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	PTH1R
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription	Recombinant Human PTH1R Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp27-Gly188) of human PTH1R/PTHR/PTHR1 (Accession #NP_000307.1.) fused with a 6×His tag at the C-terminus.
AntigenSeq	DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 6/22/2023