Comparison

Recombinant Human TIMP-2 Protein

Manufacturer Abclonal
Category
Specific against other
Amount 500 ug
Item no. RP01370-500ug
Available
Remarks (NCBI alias)
TIMP2
GeneID(Human)
TIMP2
Route
C-His
Imminogen
Cys27-Pro220
Storage
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround
Tissue inhibitors of metalloproteinases (TIMP) family are natural inhibitors of the matrix metalloproteinases (MMPs), the zinc enzymes involved in extracellular matrix maintenance and remodeling. The TIMP family encompasses four members (TIMP1-4), and they inhibit most MMPs by forming non-covalent binary complex. TIMP2 is a 22 kDa non N-glycosylated protein expressed by a variety of cell types, and plays a unique role among TIMP family members owing to its functions to regulate cellular responses to growth factors. Findings establish an unexpected, MMP-independent mechanism for TIMP2 inhibition of endothelial cell proliferation in vitro and reveal an important component of the antiangiogenic effect of TIMP2 in vivo. TIMP-2 thus is critical to the maintenance of tissue homeostasis and is involved in the regulation of tumor microenvironment.
RecommandDilutionA
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol
TIMP2
ProteinFormulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription
Recombinant Human TIMP-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys27-Pro220) of human TIMP2/CSC-21K (Accession #NP_003246.1.) fused with a 6×His tag at the C-terminus.
AntigenSeq
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 6/22/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close