« Back
Home /
Recombinant Human LILRB2/ILT-4/CD85d Protein

Recombinant Human LILRB2/ILT-4/CD85d Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	20 ug
Item no.	RP01372-20ug
Available
Remarks (NCBI alias)	LILRB2
GeneID(Human)	LILRB2
Route	C-hFc&His
Imminogen	Gln22-Val461
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround	Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2) is also known as CD85 antigen-like family member D (CD85d), Immunoglobulin-like transcript 4 (ILT-4), Monocyte / macrophage immunoglobulin-like receptor 10 (MIR-10), which is a member of the the subfamily B class of LIR receptors.Multiple transcript variants encoding different isoforms have been found for the ILT4 gene. ILT4 is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity.
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	LILRB2
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription	Recombinant Human LILRB2/ILT-4/CD85d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Val461) of human LILRB2/CD85d/ILT4 (Accession #AAH36827.1) fused with a Fc, 6×His tag at the C-terminus.
AntigenSeq	QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 6/22/2023