« Back
Home /
Recombinant Human CCL17/TARC Protein

Recombinant Human CCL17/TARC Protein

Manufacturer	Abclonal
Category	Peptides & Proteins Recombinant Proteins
Specific against	other
Amount	100 ug
Item no.	RP01374-100ug
Available
Remarks (NCBI alias)	CCL17
GeneID(Human)	CCL17
Route	C-hFc&His
Imminogen	Ala24-Ser94
Storage	Store the lyophilized protein at -20°C to -80°C for long term.\|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround	There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4.
RecommandDilutionA	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol	CCL17
ProteinFormulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription	Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of human CCL17/TARC (Accession #NP_002978.1) fused with a Fc, 6×His tag at the C-terminus.
AntigenSeq	ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 6/22/2023