Manufacturer |
Abclonal
|
Category |
|
Specific against |
other |
Amount |
500 ug |
Item no. |
RP01375-500ug |
Available |
|
Remarks (NCBI alias) |
TNFRSF1B |
GeneID(Human) |
TNFRSF1B |
Route |
C-His |
Imminogen |
Val23-Gly258 |
Storage |
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
BackGround |
Tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), also known as Tumor necrosis factor receptor 2 (TNFR2) or CD120b antigen, is a member of the tumor necrosis factor receptor superfamily. TNFR2/CD120b/TNFRSF1B is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. TNFR2/CD120b/TNFRSF1B is not a major contributing factor to the genetic risk of type 2 diabetes, its associated peripheral neuropathy and hypertension and related metabolic traits in North Indians. Tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B) has been reported to be associated with SLE risk in Japanese populations. TNFR2/CD120b/TNFRSF1B serves as a receptor with high affinity for TNFSF2 and approximately 5-fold lower affinity for homotrimeric TNFSF1. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. |
RecommandDilutionA |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Cross-Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
GeneSymbol |
TNFRSF1B |
ProteinFormulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
ProteinDescription |
Recombinant Mouse TNFRSF1B/TNF-R2/CD120b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val23-Gly258) of mouse TNFR2/CD120b/TNFRSF1B (Accession #NP_035740.2) fused with a 6×His tag at the C-terminus. |
ProteinBioActivity |
Measured by its binding ability in a functional ELISA. Immobilized Mouse TNFRSF1B at 1 μg/mL (100 μL/well) can bind Mouse TNF-alpha with a linear range of 0.64-317.13 ng/mL. |
AntigenSeq |
VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.