Comparison

Active Recombinant Human Erythropoietin/EPO Protein

Manufacturer Abclonal
Category
Specific against other
Amount 500 ug
Item no. RP01380-500ug
Available
Remarks (NCBI alias)
EPO
GeneID(Human)
EPO
Route
C-hFc
Imminogen
Ala28-Arg193
Storage
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround
Human Erythropoietin (EPO) is also known as EP, erythropoetin or erthropoyetin, and is a glycoprotein hormone that controls erythropoiesis, or red blood cell production.It has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals. Genetic variation in erythropoietin is associated with susceptbility to microvascular complications of diabetes type 2. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. It has a longer circulating half-life in vivo. Erythropoietin is being much misused as a performance-enhancing drug in endurance athletes.
RecommandDilutionA
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol
EPO
ProteinFormulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription
Active Recombinant Human Erythropoietin/EPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala28-Arg193) of human EPO/MVCD2 (Accession #NP_000790.2) fused with a hFc tag at the C-terminus.
ProteinBioActivity
Measured by its binding ability in a functional ELISA. Immobilized Human EPOR at 1 μg/mL (100 μL/well) can bind Human EPO with a linear range of 0.24-74.89 ng/mL.
AntigenSeq
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 6/22/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close