Comparison

Active Recombinant Human B29/CD79B Protein

Manufacturer Abclonal
Category
Specific against other
Amount 20 ug
Item no. RP01381-20ug
Available
Remarks (NCBI alias)
CD79B
GeneID(Human)
CD79B
Route
C-hFc
Imminogen
Ala29-Asp159
Storage
Store the lyophilized protein at -20°C to -80°C for long term.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
BackGround
B-cell antigen receptor complex-associated protein beta chain (CD79B) is also known as B-cell-specific glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 protein, B29 and IGB, which is a single-pass type I membrane protein containing one Ig-like V-type ( immunoglobulin-like ) domain and one ITAM domain.CD79b is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR).CD79b can enhance phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. Defects in CD79b are the cause of agammaglobulinemia type 6 (AGM6) that is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development.
RecommandDilutionA
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Cross-Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
GeneSymbol
CD79B
ProteinFormulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
ProteinDescription
Active Recombinant Human B29/CD79B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala29-Asp159) of human CD79b/B29 (Accession #NP_000617.1) fused with a hFc tag at the C-terminus.
ProteinBioActivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL (100 μL/well) can bind Anti-CD79B Humanized Antibody with a linear range of 0.781-1.771 ng/mL.
AntigenSeq
ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Delivery expected until 7/27/2023 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close