« Back
Home /
Recombinant Human Dkk-3 Protein

Recombinant Human Dkk-3 Protein

Item no.	RP00355-10ug
Manufacturer	Abclonal
Amount	10 ug
Quantity options	10 ug 50 ug
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton Glial Cell Markers small GTPases Ras Subfamily
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPH
NCBI	Dkk-3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DKK3,REIC,RIG,RIG,CRRL,REIC
Available
Manufacturer - Category	Proteins
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background	This protein belongs a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein.
Immunogen	Ala22-Ile350
Route	C-6xHis
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine Receptors
Bioactivity	Measured by its ability to inhibit proliferation of HeLa human cervical epithelial carcinoma cells. The ED₅₀ for this effect is 3-12 μg/mL.
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00355-10ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 12/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer